Cagrilintide (Amylin Analog) (5mg)

Cagrilintide is a novel long-acting amylin analogue featuring N-terminal lipidation that extends its half-life by binding to albumin. This synthetic peptide mimics and enhances natural amylin’s effects, simultaneously targeting multiple metabolic and appetite regulation pathways in both homeostatic and hedonic systems.

$170.00

Buy in bulk and save

Cagrilintide Description

Cagrilintide is a novel long-acting amylin analog featuring N-terminal lipidation that extends its half-life by binding to albumin. This synthetic peptide mimics and enhances natural amylin’s effects, simultaneously targeting multiple metabolic and appetite regulation pathways in both homeostatic and hedonic systems.

Peptide Information

Property Value
Peptide Sequence XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP
Molecular Formula C194H312N54O59S2
Molecular Weight 4409 g/mol
CAS Number 1415456-99-3
PubChem CID 171397054
Synonyms 1415456-99-3, Cagrilintide [INN], AO43BIF1U8, LDERDVMBIYGIOI-IZVMHKDJSA-N

Cagrilintide Peptide Structure

Image showing Cagrilintide peptide structure

Source: PubChem

Lyophilized Peptides:

Our cagrilintide is provided as a lyophilized (freeze-dried) powder. This process extends shelf life and preserves the purity and integrity of the peptide without the use of any fillers.

Cagrilintide Research

Cagrilintide is a long-acting amylin analogue developed to address the limitations of existing amylin analogues like pramlintide, which have a short half-life. Cagrilintide is designed to be more stable and is lipidated to extend its duration of action. It has shown significant potential in inducing weight loss, both as a standalone treatment and in combination with GLP-1 analogues like semaglutide.

Weight Management and Obesity Efficacy

Clinical trials have demonstrated that cagrilintide effectively reduces body weight in individuals with obesity. In a phase 2 trial, cagrilintide led to greater weight reductions compared to placebo and liraglutide, with the highest dose achieving a mean weight reduction of 10.8%1.

When combined with semaglutide, cagrilintide showed enhanced weight loss and improved glycaemic control in individuals with type 2 diabetes2.  A meta-analysis of RCTs also showed that this combination (CagriSema) resulted in significantly greater weight loss compared to semaglutide alone8.

Comparative Studies

Cagrilintide has been compared to other dual amylin and calcitonin receptor agonists (DACRAs) like KBP-336. While both show efficacy in weight loss and glucose control, KBP-336 has demonstrated superior long-term efficacy in preclinical models, suggesting differences in receptor activation balance3.

Combination therapies involving cagrilintide and other agents like tirzepatide have shown promising results in enhancing weight loss and reducing food intake, highlighting the potential for combinatorial approaches in obesity management4.

Cardiovascular Health

Amylin-based therapies, including cagrilintide, are being investigated for their potential cardiovascular benefits, such as vasodilatory, anti-inflammatory, and anti-atherosclerotic effects. These therapies are scrutinized for their impact on blood pressure, lipid profiles, and cardiovascular markers. Amylin analogs may offer innovative approaches to enhance metabolic and cardiovascular health, potentially reducing the global burden of cardiovascular diseases5.

Glycemic Control

Cagrilintide controls hyperglycemia through various actions. In a phase 2 trial of obese patients with type 2 diabetes, CagriSema reduced glycated hemoglobin (HbA1c) levels. At 32 weeks, the reduction in HbA1c levels with CagriSema was statistically superior to cagrilintide alone, but not statistically greater than semaglutide6. Another study combining semaglutide and cagrilintide found that CagriSema improved glycemic control7.

References

  1. Lau, D., Erichsen, L., Francisco, A., Satylganova, A., Roux, C., McGowan, B., Pedersen, S., Pietiläinen, K., Rubino, D., & Batterham, R. (2021). Once-weekly cagrilintide for weight management in people with overweight and obesity: a multicentre, randomised, double-blind, placebo-controlled and active-controlled, dose-finding phase 2 trial. The Lancet, 398, 2160-2172. https://doi.org/10.1016/S0140-6736(21)01751-7.
  2. Enebo, L., Berthelsen, K., Kankam, M., Lund, M., Rubino, D., Satylganova, A., & Lau, D. (2021). Safety, tolerability, pharmacokinetics, and pharmacodynamics of concomitant administration of multiple doses of cagrilintide with semaglutide 2·4 mg for weight management: a randomised, controlled, phase 1b trial. The Lancet, 397, 1736-1748. https://doi.org/10.1016/S0140-6736(21)00845-X.
  3. Larsen, A., Mohamed, K., Sonne, N., Bredtoft, E., Andersen, F., Karsdal, M., & Henriksen, K. (2022). Does receptor balance matter? – Comparing the efficacies of the dual amylin and calcitonin receptor agonists cagrilintide and KBP-336 on metabolic parameters in preclinical models.. Biomedicine & pharmacotherapy = Biomedecine & pharmacotherapie, 156, 113842 . https://doi.org/10.1016/j.biopha.2022.113842.
  4. Valdecantos, P., Rada, P., Ghosh, S., Rondinone, C., & Valverde, A. (2024). 300-OR: Beneficial Effect of the Combination Therapy of Cagrilintide, a Dual Amylin/Calcitonin Agonist, and Tirzepatide, a Dual GLP-1/GIP Agonist, on Body Weight Loss in Obese Rats. Diabeteshttps://doi.org/10.2337/db24-300-or.
  5. Badshah I. Unlocking the Potential: Amylin-Based Therapies as Novel Interventions for Addressing the Nexus of Obesity and Cardiovascular Health. J Endo Metabol Res. 2024;5(1):19-35. https://doi.org/10.37191/Mapsci-2582-7960-5(1)-036
  6. Mikhail, N. (2023). Cagrilintide Combined with Semaglutide: a new Approach for Treatment of Obesity and type 2 Diabetes. Clinical Research and clinical Trialshttps://doi.org/10.31579/2693-4779/154.
  7. Frias, J.P., Deenadayalan, S., Erichsen, L., Knop, F.K., Lingvay, I., Macura, S., Mathieu, C., Pedersen, S.D., & Davies, M.J. (2023). 53-OR: Efficacy and Safety of Coadministered s.c. Semaglutide and s.c. Cagrilintide in Type 2 Diabetes. Diabetes. https://doi.org/10.2337/db23-53-OR.
  8. Dutta, D., Nagendra, L., Harish, B., Sharma, M., Joshi, A., Hathur, B., & Kamrul-Hasan, A. (2024). Efficacy and Safety of Cagrilintide Alone and in Combination with Semaglutide (Cagrisema) as Anti-Obesity Medications: A Systematic Review and Meta-Analysis. Indian Journal of Endocrinology and Metabolism, 28, 436 – 444. https://doi.org/10.4103/ijem.ijem_45_24.

[show_single_product_pdfs]

Browse our full peptide catalog featuring research compounds for a wide range of scientific applications:

Disclaimer: For Research Purposes Only

This content is provided strictly for research purposes and does not constitute an endorsement or recommendation for the non-laboratory application or improper handling of peptides designed for research. The information, including discussions about specific peptides and their researched benefits, is presented for informational purposes only and must not be construed as health, clinical, or legal guidance, nor an encouragement for non-research use in humans. Peptides described here are solely for use in structured scientific study by authorized individuals. We advise consulting with research experts, medical practitioners, or legal counsel prior to any decisions about obtaining or utilizing these peptides. The expectation of responsible, ethical utilization of this information for legitimate investigative and scholarly objectives is paramount. This notice is dynamic and governs all provided content on research peptides.